AibGenesis™ Mouse Anti-BPHL Antibody (CBMOAB-37057FYA)


Cat: CBMOAB-37057FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37057FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO37057FYA 100 µg
MO-AB-01912H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01912C 100 µg
MO-AB-09106R Monoclonal Cattle (Bos taurus) WB, ELISA MO09106R 100 µg
MO-AB-25904W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25904W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO37057FYA
SpecificityThis antibody binds to Rhesus BPHL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described. (From NCBI)
Product OverviewMouse Anti-Rhesus BPHL Antibody is a mouse antibody against BPHL. It can be used for BPHL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBPHL
UniProt IDF7H0W6
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MCGDAQEPALFSFVVPPLPHFRTSVTSAKVAVNGVQLHYQQTGEGGHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPQVQCPTLIVHGEKDPLVPRFHANFIHEHVKGSRLHLMPEGKHNLHLRFANEFNRLAEGFLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry