Mouse Anti-BRF2 Antibody (CBMOAB-37110FYA)


Cat: CBMOAB-37110FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37110FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO37110FYA 100 µg
CBMOAB-67945FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67945FYA 100 µg
MO-AB-09132R Monoclonal Cattle (Bos taurus) WB, ELISA MO09132R 100 µg
MO-AB-21488W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21488W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO37110FYA
SpecificityThis antibody binds to Rhesus BRF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein. (From NCBI)
Product OverviewMouse Anti-Rhesus BRF2 Antibody is a mouse antibody against BRF2. It can be used for BRF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor IIIB 50 kDa subunit; BRF2
UniProt IDH9ZAV1
Protein RefseqThe length of the protein is 419 amino acids long.
The sequence is show below: MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQISRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSIYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTLQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKQSVVKHIGDLLQHRHSLVRLAFRDGTAEVETRGKEPPAWGQGQREGEVGNNSLGLPQGKRPASPALLLPPCMLKPPKRICPAPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry