AibGenesis™ Mouse Anti-BSPRY Antibody (CBMOAB-37138FYA)


Cat: CBMOAB-37138FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37138FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO37138FYA 100 µg
CBMOAB-67999FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67999FYA 100 µg
MO-AB-51978W Monoclonal Marmoset WB, ELISA MO51978W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO37138FYA
SpecificityThis antibody binds to Rhesus BSPRY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BSPRY Antibody is a mouse antibody against BSPRY. It can be used for BSPRY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBSPRY
UniProt IDF6TT06
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MSAEGAELGPGSGPGPGPEPGPLCPEHGQALSWFCRSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTSLVGMLTHLDDLQLIQKEQEIFERHRGHTDR.
For Research Use Only | Not For Clinical Use.
Online Inquiry