Mouse Anti-Rhesus BTK Antibody (CBMOAB-37170FYA)
Cat: CBMOAB-37170FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO37170FYA |
Specificity | This antibody binds to Rhesus BTK. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Product Overview | Mouse Anti-Rhesus BTK Antibody is a mouse antibody against BTK. It can be used for BTK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tyrosine-protein kinase BTK; BTK |
UniProt ID | H9FLW7 |
Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: NLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKST. |
See other products for " btk "
CBMOAB-68059FYA | Mouse Anti-Zebrafish btk Antibody (CBMOAB-68059FYA) |
MO-AB-00920Y | Mouse Anti-Chicken BTK Antibody (MO-AB-00920Y) |
MO-AB-03432W | Mouse Anti-Rhesus BTK Antibody (MO-AB-03432W) |
MO-AB-09183R | Mouse Anti-Cattle BTK Antibody (MO-AB-09183R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry