Mouse Anti-BTK Antibody (CBMOAB-37170FYA)


Cat: CBMOAB-37170FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37170FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO37170FYA 100 µg
CBMOAB-68059FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68059FYA 100 µg
MO-AB-00920Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00920Y 100 µg
MO-AB-03432W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03432W 100 µg
MO-AB-09183R Monoclonal Cattle (Bos taurus) WB, ELISA MO09183R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO37170FYA
SpecificityThis antibody binds to Rhesus BTK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus BTK Antibody is a mouse antibody against BTK. It can be used for BTK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine-protein kinase BTK; BTK
UniProt IDH9FLW7
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: NLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKST.
For Research Use Only | Not For Clinical Use.
Online Inquiry