AibGenesis™ Mouse Anti-BTK Antibody (CBMOAB-37170FYA)
Cat: CBMOAB-37170FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-37170FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) | WB, ELISA | MO37170FYA | 100 µg | ||
| CBMOAB-68059FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO68059FYA | 100 µg | ||
| MO-AB-00920Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00920Y | 100 µg | ||
| MO-AB-03432W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03432W | 100 µg | ||
| MO-AB-09183R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09183R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) |
| Clone | MO37170FYA |
| Specificity | This antibody binds to Rhesus BTK. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus BTK Antibody is a mouse antibody against BTK. It can be used for BTK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tyrosine-protein kinase BTK; BTK |
| UniProt ID | H9FLW7 |
| Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: NLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKST. |
For Research Use Only | Not For Clinical Use.
Online Inquiry