AibGenesis™ Mouse Anti-C11orf49 Antibody (CBMOAB-37258FYA)


Cat: CBMOAB-37258FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37258FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO37258FYA 100 µg
MO-AB-01358W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01358W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO37258FYA
SpecificityThis antibody binds to Rhesus C11orf49.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC11orf49 (Chromosome 11 Open Reading Frame 49) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus C11orf49 Antibody is a mouse antibody against C11orf49. It can be used for C11orf49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC11orf49
UniProt IDH9YW91
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGEAGMLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHHGINQALGALPDKGDLMHDPAMDEELERLLLPFFRLAQVPGLVNSITASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET.
For Research Use Only | Not For Clinical Use.
Online Inquiry