AibGenesis™ Mouse Anti-C16orf93 Antibody (CBMOAB-37410FYA)


Cat: CBMOAB-37410FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37410FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37410FYA 100 µg
MO-AB-20026W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20026W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37410FYA
SpecificityThis antibody binds to Rhesus C16orf93.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C16orf93 Antibody is a mouse antibody against C16orf93. It can be used for C16orf93 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC16orf93
UniProt IDF7HL68
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MASYCEFWGPLQIRRPGHHSCLPQFAFFPQPPLPRPRICMWKYLDIHSMHQLEKTTSAEEMRQVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQTSAACALLQDLHKACIATPLGNVEECYHYFTSVLFCHGVRRPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEASKEVEEQAVTPQEEELETVAPPEPEPSHVHILRAYIKTQMNKELEELQQLVEEQLKASEERLSSKLTALERPFQLPPGKGKSKTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry