Mouse Anti-C19orf40 Antibody (CBMOAB-37483FYA)


Cat: CBMOAB-37483FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37483FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37483FYA 100 µg
MO-AB-16184W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16184W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37483FYA
SpecificityThis antibody binds to Rhesus C19orf40.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C19orf40 Antibody is a mouse antibody against C19orf40. It can be used for C19orf40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFanconi anemia-associated protein of 24 kDa; C19orf40
UniProt IDH9Z1Y9
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MEKKPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCVLYVTEADLVAGNGYRKRLVRGRNSGNLQGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLRKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIRELEQVVGQAVAKQIHAFFTQPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry