AibGenesis™ Mouse Anti-C1orf43 Antibody (CBMOAB-37560FYA)


Cat: CBMOAB-37560FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37560FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO37560FYA 100 µg
MO-AB-13622W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13622W 100 µg
MO-AB-24216R Monoclonal Pig (Sus scrofa) WB, ELISA MO24216R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO37560FYA
SpecificityThis antibody binds to Rhesus C1orf43.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1orf43 Antibody is a mouse antibody against C1orf43. It can be used for C1orf43 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1orf43
UniProt IDF7GRW2
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKSPPLHSSLGDRARLHLKKKKKKNKNERKYIIAVFSTEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATVVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry