AibGenesis™ Mouse Anti-C1QL2 Antibody (CBMOAB-37595FYA)


Cat: CBMOAB-37595FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37595FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO37595FYA 100 µg
CBMOAB-68266FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68266FYA 100 µg
MO-AB-24217R Monoclonal Pig (Sus scrofa) WB, ELISA MO24217R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO37595FYA
SpecificityThis antibody binds to Rhesus C1QL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QL2 Antibody is a mouse antibody against C1QL2. It can be used for C1QL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1QL2
UniProt IDF6W5H6
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MMGTCRMICDPYTAAPGGGPAGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTAGGVGVVGGGAGGAGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD.
For Research Use Only | Not For Clinical Use.
Online Inquiry