AibGenesis™ Mouse Anti-C1QTNF8 Antibody (CBMOAB-37604FYA)


Cat: CBMOAB-37604FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37604FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO37604FYA 100 µg
MO-AB-09271R Monoclonal Cattle (Bos taurus) WB, ELISA MO09271R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO37604FYA
SpecificityThis antibody binds to Rhesus C1QTNF8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QTNF8 Antibody is a mouse antibody against C1QTNF8. It can be used for C1QTNF8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC1QTNF8
UniProt IDF7G317
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MAAPTLLLLALLLPAGAWPGLPRRPCVHCCHPAWPPGPYARVSDGDPWRSLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRKGQKGQVGPPGAPCQRAYAAFSVGRREGLHSSDDFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQREQDNAVYGERGDLYITFSGHLVKPAAEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry