AibGenesis™ Mouse Anti-C21orf58 Antibody (CBMOAB-37634FYA)


Cat: CBMOAB-37634FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37634FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37634FYA 100 µg
MO-AB-13451W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13451W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37634FYA
SpecificityThis antibody binds to Rhesus C21orf58.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC21orf58 (Chromosome 21 Open Reading Frame 58) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus C21orf58 Antibody is a mouse antibody against C21orf58. It can be used for C21orf58 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC21orf58
UniProt IDF6S0R9
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MLDSSAAEHVTRLTLKLLGQKLERERQSMEGGPEGLHLEPGNEDRPDDALQTALKRRDLLQRLREQHLLDELSRAQAWNGASRGALGSALPPELPPTGILPAASPTPLAPDLPRIILPTLCLPNPSPGLKSQQAEGPEFGEVEPPTAKLSSGSPCLPTDMVELLLLQNAQVHQLVLQNWMLKALPPALQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry