Mouse Anti-CADM2 Antibody (MO-AB-01466W)


Cat: MO-AB-01466W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01466W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO01466W 100 µg
MO-AB-18969W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18969W 100 µg
MO-AB-24486H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24486C 100 µg
MO-AB-52119W Monoclonal Marmoset WB, ELISA MO52119W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO01466W
SpecificityThis antibody binds to Rhesus CADM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CADM2 Antibody is a mouse antibody against CADM2. It can be used for CADM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCell adhesion molecule 2 isoform 2; CADM2
UniProt IDH9ENT6
Protein RefseqThe length of the protein is 404 amino acids long.
The sequence is show below: MIWKRSAVLRFYSVCGLLLQAAASKNKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry