AibGenesis™ Mouse Anti-CASC4 Antibody (CBMOAB-38160FYA)


Cat: CBMOAB-38160FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38160FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38160FYA 100 µg
CBMOAB-69058FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69058FYA 100 µg
MO-AB-00977Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00977Y 100 µg
MO-AB-01512W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01512W 100 µg
MO-AB-09507R Monoclonal Cattle (Bos taurus) WB, ELISA MO09507R 100 µg
MO-AB-26019W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26019W 100 µg
MO-AB-52269W Monoclonal Marmoset WB, ELISA MO52269W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO38160FYA
SpecificityThis antibody binds to Rhesus CASC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Alternatively spliced variants encoding different isoforms have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus CASC4 Antibody is a mouse antibody against CASC4. It can be used for CASC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCASC4
UniProt IDF7H1X9
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MVGFGANRRAGRLPSLVLVVLLVVIVVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDTHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESKSPTRFNQMVEKNWI.
For Research Use Only | Not For Clinical Use.
Online Inquiry