Mouse Anti-CBLN4 Antibody (CBMOAB-38233FYA)


Cat: CBMOAB-38233FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38233FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38233FYA 100 µg
CBMOAB-69192FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69192FYA 100 µg
MO-AB-02115H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02115C 100 µg
MO-AB-09574R Monoclonal Cattle (Bos taurus) WB, ELISA MO09574R 100 µg
MO-AB-24359R Monoclonal Pig (Sus scrofa) WB, ELISA MO24359R 100 µg
MO-AB-24529H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24529C 100 µg
MO-AB-52311W Monoclonal Marmoset WB, ELISA MO52311W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38233FYA
SpecificityThis antibody binds to Rhesus CBLN4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. (From NCBI)
Product OverviewMouse Anti-Rhesus CBLN4 Antibody is a mouse antibody against CBLN4. It can be used for CBLN4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCerebellin-4; CBLN4
UniProt IDH9FA38
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: RALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry