AibGenesis™ Mouse Anti-CBY3 Antibody (CBMOAB-38255FYA)


Cat: CBMOAB-38255FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38255FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO38255FYA 100 µg
MO-AB-24539H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24539C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO38255FYA
SpecificityThis antibody binds to Rhesus CBY3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CBY3 Antibody is a mouse antibody against CBY3. It can be used for CBY3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein chibby homolog 3; CBY3
UniProt IDH9FCV1
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: LAAPPGSPSSFWTSGLPRQARSKSRQRSRGSPPSSCVPYKVHALATFECLATSHASRLWEQLQQFWADHISRPFSPRRPPLRRMSSLSTFYLLDHNTRQAELGLAYGAPRMRLSNQAFVFRGGRWTTEGPLARPRSPLLSRTASSWKAQVQQTKSQVLLEENNYLKLQQELLMDMMTEAMARMHLLEKKLNPEVTPTAAARAWQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry