AibGenesis™ Mouse Anti-CCBL2 Antibody (CBMOAB-38277FYA)


Cat: CBMOAB-38277FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38277FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38277FYA 100 µg
CBMOAB-69277FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69277FYA 100 µg
MO-AB-52353W Monoclonal Marmoset WB, ELISA MO52353W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO38277FYA
SpecificityThis antibody binds to Rhesus CCBL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus CCBL2 Antibody is a mouse antibody against CCBL2. It can be used for CCBL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCBL2
UniProt IDF6ZP12
Protein RefseqThe length of the protein is 421 amino acids long.
The sequence is show below: KMSLKFTNAKRIEGLDGNMWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKISAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVDGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNKEELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKGGACLQPNYFFKTINNITIFLFIFFNSDKQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVHLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry