AibGenesis™ Mouse Anti-CCDC115 Antibody (CBMOAB-38296FYA)


Cat: CBMOAB-38296FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38296FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38296FYA 100 µg
CBMOAB-69294FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69294FYA 100 µg
MO-AB-09601R Monoclonal Cattle (Bos taurus) WB, ELISA MO09601R 100 µg
MO-AB-10735W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10735W 100 µg
MO-AB-24543H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24543C 100 µg
MO-AB-52366W Monoclonal Marmoset WB, ELISA MO52366W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38296FYA
SpecificityThis antibody binds to Rhesus CCDC115.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. (From NCBI)
Product OverviewMouse Anti-Rhesus CCDC115 Antibody is a mouse antibody against CCDC115. It can be used for CCDC115 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 115; CCDC115
UniProt IDI2CVK2
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MAALDLRAELDSVLLQLLGDLEELEGKRAVLNARVEEGWLSLAKARYAMGTKSVGPLQYASHMEPQVCLQASEAQEGLQKFKVVRSGVHAPEEVGPREAALRRRKGPTKTPEPQSSEAPRDPLNWFGILVPHSLRQAQASFRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLELGAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry