Mouse Anti-CCDC152 Antibody (CBMOAB-38362FYA)


Cat: CBMOAB-38362FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38362FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO38362FYA 100 µg
CBMOAB-60364FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60364FYC 100 µg
MO-AB-09618R Monoclonal Cattle (Bos taurus) WB, ELISA MO09618R 100 µg
MO-AB-24548H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24548C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO38362FYA
SpecificityThis antibody binds to Rhesus CCDC152.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC152 Antibody is a mouse antibody against CCDC152. It can be used for CCDC152 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC152
UniProt IDF7HQ63
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: SGKGDCEKLGATADMDQSSEGCMKKISSVNLDKLINDFSQIEKKMIETNGKNNILDIQLEKTNCLLKVMQAKEVSIKEECATLHNIIKGLQQTIECQQNLKGENEQLKISADLIKEKLKSHEQEYKNNIAKLVSEMKIKEEGYKTEISKLYQDMQKKVELNEEKHKELIEKKEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYPDSTALPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVDKDSHLKRRRF.
For Research Use Only | Not For Clinical Use.
Online Inquiry