AibGenesis™ Mouse Anti-CCDC155 Antibody (CBMOAB-38366FYA)


Cat: CBMOAB-38366FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38366FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO38366FYA 100 µg
MO-AB-09620R Monoclonal Cattle (Bos taurus) WB, ELISA MO09620R 100 µg
MO-AB-52387W Monoclonal Marmoset WB, ELISA MO52387W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO38366FYA
SpecificityThis antibody binds to Rhesus CCDC155.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC155 Antibody is a mouse antibody against CCDC155. It can be used for CCDC155 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC155
UniProt IDF6WCS2
Protein RefseqThe length of the protein is 443 amino acids long.
The sequence is show below: MDLPEGPVGGPTAEMYLWEQPEETRLGMPVSLEEQILNSTFEACDPQRTGTVAVTQVLAYLEAVTGQGPQDARLQTLANSLDPNGEGPNATVDLDTFLVVMRDWIAACQLHGGLELEEETAFEGALTSQQLPSGCPEAEEPANLESFSDEDPRPELQATADLLSSLEDLELSNQRLAGENAKLQRSVETAEEGSARLGEEILALRKQLRSTQQALQFAKAVDEELEDLKTLARSLEEQNRSLLAQARQAEKEQQHLVAEMETLQEEKNIILVHSGPTLKQTHQLTMKPVTTPHLKFISEHLFLRMKKKVNRRTRRISDLFQPLEWQRLLTYELRLEISRLEEQLSQTYEGPDELPEGAQLRRVGWTRLLPPSLGLEIEAIRQKQEVAIAGLSNPLCGVWQWEEVIHDTSEDAEFPSEAPAGGQRNFQGQPAHHGEGRKEPSMW.
For Research Use Only | Not For Clinical Use.
Online Inquiry