Mouse Anti-CCDC183 Antibody (CBMOAB-38398FYA)


Cat: CBMOAB-38398FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38398FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38398FYA 100 µg
MO-AB-09628R Monoclonal Cattle (Bos taurus) WB, ELISA MO09628R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38398FYA
SpecificityThis antibody binds to Rhesus CCDC183.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC183 Antibody is a mouse antibody against CCDC183. It can be used for CCDC183 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC183
UniProt IDF7AKL9
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: MVNLGLSRVDDAVAARHPGLGEYAACQSHAFMKGVFTFVTGTGVAFGLQMFIQRKFPYPLQWSLLVAVVAGSVASYGVTRVESKKCSNLWLFLETGQLPKDMSTDRRSQERSGRSTEDWGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry