Mouse Anti-CCDC54 Antibody (CBMOAB-38436FYA)


Cat: CBMOAB-38436FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38436FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38436FYA 100 µg
MO-AB-09649R Monoclonal Cattle (Bos taurus) WB, ELISA MO09649R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38436FYA
SpecificityThis antibody binds to Rhesus CCDC54.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCDC54 (Coiled-Coil Domain Containing 54) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CCDC54 Antibody is a mouse antibody against CCDC54. It can be used for CCDC54 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC54
UniProt IDF7EG13
Protein RefseqThe length of the protein is 328 amino acids long.
The sequence is show below: MYTLHTKRVKAAAREMWTSNVSKVRQSFKNVYHKCKIRHQDSTRYPTVTSDDCNQDDVSYDGKMNLTVVLQDVKTAQVELFSQMTDIVHAIPKVHEKTDLYQKQMEVLETRMNVNEDKQGTTTKDILSMKEDIKALKKKVTELEKQNSYSRIHCLEIPEGERGEEITELLYKLIQPATLKNTLASTDREMSSAEPEKVPSYPKSTDHLEKITISPQIKTLKKRNHQNASRNFKTAKPNIYIYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPTILPEEPQVITQRYCPFTGLILSLTTICLSMFNNIYGFIRSLKEEVTRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry