AibGenesis™ Mouse Anti-CCDC58 Antibody (CBMOAB-38443FYA)


Cat: CBMOAB-38443FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38443FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38443FYA 100 µg
CBMOAB-69404FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69404FYA 100 µg
MO-AB-02336W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02336W 100 µg
MO-AB-09650R Monoclonal Cattle (Bos taurus) WB, ELISA MO09650R 100 µg
MO-AB-24563H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24563C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38443FYA
SpecificityThis antibody binds to Rhesus CCDC58.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCDC58 (Coiled-Coil Domain Containing 58) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CCDC58 Antibody is a mouse antibody against CCDC58. It can be used for CCDC58 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 58; CCDC58
UniProt IDH9FA26
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: PSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRVIKNCIAQTSAVVKNLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWKVFNERCRIHFKPPKNE.
For Research Use Only | Not For Clinical Use.
Online Inquiry