AibGenesis™ Mouse Anti-CCDC63 Antibody (CBMOAB-38450FYA)


Cat: CBMOAB-38450FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38450FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO38450FYA 100 µg
MO-AB-02146H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02146C 100 µg
MO-AB-09652R Monoclonal Cattle (Bos taurus) WB, ELISA MO09652R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO38450FYA
SpecificityThis antibody binds to Rhesus CCDC63.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC63 Antibody is a mouse antibody against CCDC63. It can be used for CCDC63 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC63
UniProt IDF7FFY8
Protein RefseqThe length of the protein is 447 amino acids long.
The sequence is show below: LPQLKKHRRKDSDTPQELSEKAKEQQAEAELRKLRQQFRKMVESRKSFNFRNQQKIASQYKEIQSLKAEQDEITLLLSLMKSSRNMNRSEKNYMELCLLLQTKEDYEALIKSLKVLLAELDEKIVEMEKKIANQKQIFTKIQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRKEIEDLRFEKAAYDNVYQQLQRCLLMQKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKKDISQYNLEIRELERLYAHESRLKSFLLVKLNDRNEFEEQAKREEALKAKKHVKKSKGESFESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQQSSHDDSRSALRQLEDKLRKTTEEADMYESKYREVSKTLDLLKNSVEKLFKKINCDATKILVQLGETGKVTDINLPQYF.
For Research Use Only | Not For Clinical Use.
Online Inquiry