Mouse Anti-Rhesus CCL8 Antibody (CBMOAB-38552FYA)


Cat: CBMOAB-38552FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38552FYA
SpecificityThis antibody binds to Rhesus CCL8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL8 (C-C Motif Chemokine Ligand 8) is a Protein Coding gene. Diseases associated with CCL8 include Diffuse Gastric Cancer. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include protein kinase activity and chemokine activity. An important paralog of this gene is CCL11.
Product OverviewMouse Anti-Rhesus CCL8 Antibody is a mouse antibody against CCL8. It can be used for CCL8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine; CCL8
UniProt IDF6Y1K4
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry