AibGenesis™ Mouse Anti-CCSAP Antibody (CBMOAB-38606FYA)


Cat: CBMOAB-38606FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38606FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38606FYA 100 µg
CBMOAB-69632FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69632FYA 100 µg
MO-AB-24605H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24605C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38606FYA
SpecificityThis antibody binds to Rhesus CCSAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCSAP Antibody is a mouse antibody against CCSAP. It can be used for CCSAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCSAP
UniProt IDF6SB46
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MVPVFTSSALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRRLVAQRQRAHSVDVEKNRKVKASSSENPWMTEYMRCYSARA.
For Research Use Only | Not For Clinical Use.
Online Inquiry