Mouse Anti-CD164L2 Antibody (CBMOAB-38630FYA)


Cat: CBMOAB-38630FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38630FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38630FYA 100 µg
CBMOAB-69659FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69659FYA 100 µg
MO-AB-09776R Monoclonal Cattle (Bos taurus) WB, ELISA MO09776R 100 µg
MO-AB-24612H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24612C 100 µg
MO-AB-52536W Monoclonal Marmoset WB, ELISA MO52536W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38630FYA
SpecificityThis antibody binds to Rhesus CD164L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD164L2 Antibody is a mouse antibody against CD164L2. It can be used for CD164L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD164L2
UniProt IDF7HFA4
Protein RefseqThe length of the protein is 173 amino acids long.
The sequence is show below: MEASGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVCEHCVEGDRARNLSGCVWEQCQPEEPGHCVAQAEVVKEGCSIYNRSEACPAAHHHPTYEPKTVTTGGPPVPEAHSPGFDGASFIGGVVLVLSLQAVAFFVLRFLKAKDSTYQTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry