Mouse Anti-Rhesus CD22 Antibody (CBMOAB-38672FYA)


Cat: CBMOAB-38672FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38672FYA
SpecificityThis antibody binds to Rhesus CD22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD22 (CD22 Molecule) is a Protein Coding gene. Diseases associated with CD22 include Refractory Hematologic Cancer and Refractory Hairy Cell Leukemia. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Innate Immune System. Gene Ontology (GO) annotations related to this gene include carbohydrate binding. An important paralog of this gene is SIGLEC1.
Product OverviewMouse Anti-Rhesus CD22 Antibody is a mouse antibody against CD22. It can be used for CD22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD22
UniProt IDF6W485
Protein RefseqThe length of the protein is 848 amino acids long.
The sequence is show below: MHLLGPWLLLLVLEYLAFSDSSKWNIEHPGTIYAWEGACVWVPCTYRVLDGALETFILFHNPEYNQNMSKFEGTRLYESTKDGKVPSGQKRVQFLGNKINNNCTLSIHPVHVNDSGQLGLRMVSKTEKWMERIHLNVSERPFPPRIQLPPKLQESQEVTLTCLLNFSCYGYQIQLQWLLEGVPMRQAAVTSTSLSTKSVFTRSELKFSPQWSHHGKIVTCELHDVDGKVLSEDMVQLNVKHTPKLTIEVTPNETIVRKGDSVTMTCKVNSSNPEYTTVSWLKDGIPLKEQNTLMLTLHEVTKSQSGRYCCRVSNDVGPATSEKVFLQVQYAPEPSRVQISQSPAVEGSEVNFLCISPANPLPTNYTWYHNGKEVQGRTEKQFQIQKILPWHAGTYSCEAENILGIGERGPGTELDVQYPPKKVTMVIENPTPIREGDTVTLSCNYSSSNPIVNHYEWRPRGAWEEPSLGVLKIQNIGWNNTAVACAACNNWCSWASPVTLNVLYAPRGVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGSLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSQGNQVMEGKTATLICESDANPPVYSYAWFDWNNQSLPYSGRMLRLEPVKVQHSGAYWCQGTNRVGKGHSPLITLTVYYSPQTIGRRVAVGLGSCLAILILAMCGFKVQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRTPLSEGPHSLGCYNPMMEDGISYATLRFPETNTPRTGDAETSKLQRPPPDCDDTVTYSVLQKRQVGDYENVIPDFPEDEGIHYSELIQFGFGERPQAQENVDYVIVKH.

Reference

Reference1. Li, J. L., Shen, G. L., Ghetie, M. A., May, R. D., Till, M., Ghetie, V., ... & Vitetta, E. S. (1989). The epitope specificity and tissue reactivity of four murine monoclonal anti-CD22 antibodies. Cellular immunology, 118(1), 85-99.
2. Demberg, T., Mohanram, V., Musich, T., Brocca-Cofano, E., McKinnon, K. M., Venzon, D., & Robert-Guroff, M. (2015). Loss of marginal zone B-cells in SHIVSF162P4 challenged rhesus macaques despite control of viremia to low or undetectable levels in chronic infection. Virology, 484, 323-333.
For Research Use Only | Not For Clinical Use.
Online Inquiry