Mouse Anti-CD22 Antibody (CBMOAB-38672FYA)


Cat: CBMOAB-38672FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38672FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Primate, Zebrafish (Danio rerio) WB, ELISA MO38672FYA 100 µg
CBMOAB-69665FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69665FYA 100 µg
MO-AB-18616W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18616W 100 µg
MO-NAB-00197W Monoclonal Human (Homo sapiens), Primate, Rhesus (Macaca mulatta) FC, IP, Neut hl22 (Epratuzumab) 100 µg
MO-NAB-00226W Monoclonal Human (Homo sapiens), Primate, Rhesus (Macaca mulatta) FC, FuncS, IP hL22 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Primate, Zebrafish (Danio rerio)
CloneMO38672FYA
SpecificityThis antibody binds to Rhesus CD22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD22 (CD22 Molecule) is a Protein Coding gene. Diseases associated with CD22 include Refractory Hematologic Cancer and Refractory Hairy Cell Leukemia. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Innate Immune System. Gene Ontology (GO) annotations related to this gene include carbohydrate binding. An important paralog of this gene is SIGLEC1.
Product OverviewMouse Anti-Rhesus CD22 Antibody is a mouse antibody against CD22. It can be used for CD22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD22
UniProt IDF6W485
Protein RefseqThe length of the protein is 848 amino acids long.
The sequence is show below: MHLLGPWLLLLVLEYLAFSDSSKWNIEHPGTIYAWEGACVWVPCTYRVLDGALETFILFHNPEYNQNMSKFEGTRLYESTKDGKVPSGQKRVQFLGNKINNNCTLSIHPVHVNDSGQLGLRMVSKTEKWMERIHLNVSERPFPPRIQLPPKLQESQEVTLTCLLNFSCYGYQIQLQWLLEGVPMRQAAVTSTSLSTKSVFTRSELKFSPQWSHHGKIVTCELHDVDGKVLSEDMVQLNVKHTPKLTIEVTPNETIVRKGDSVTMTCKVNSSNPEYTTVSWLKDGIPLKEQNTLMLTLHEVTKSQSGRYCCRVSNDVGPATSEKVFLQVQYAPEPSRVQISQSPAVEGSEVNFLCISPANPLPTNYTWYHNGKEVQGRTEKQFQIQKILPWHAGTYSCEAENILGIGERGPGTELDVQYPPKKVTMVIENPTPIREGDTVTLSCNYSSSNPIVNHYEWRPRGAWEEPSLGVLKIQNIGWNNTAVACAACNNWCSWASPVTLNVLYAPRGVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGSLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSQGNQVMEGKTATLICESDANPPVYSYAWFDWNNQSLPYSGRMLRLEPVKVQHSGAYWCQGTNRVGKGHSPLITLTVYYSPQTIGRRVAVGLGSCLAILILAMCGFKVQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRTPLSEGPHSLGCYNPMMEDGISYATLRFPETNTPRTGDAETSKLQRPPPDCDDTVTYSVLQKRQVGDYENVIPDFPEDEGIHYSELIQFGFGERPQAQENVDYVIVKH.

Reference

Reference1. Li, J. L., Shen, G. L., Ghetie, M. A., May, R. D., Till, M., Ghetie, V., ... & Vitetta, E. S. (1989). The epitope specificity and tissue reactivity of four murine monoclonal anti-CD22 antibodies. Cellular immunology, 118(1), 85-99.
2. Demberg, T., Mohanram, V., Musich, T., Brocca-Cofano, E., McKinnon, K. M., Venzon, D., & Robert-Guroff, M. (2015). Loss of marginal zone B-cells in SHIVSF162P4 challenged rhesus macaques despite control of viremia to low or undetectable levels in chronic infection. Virology, 484, 323-333.
For Research Use Only | Not For Clinical Use.
Online Inquiry