Mouse Anti-Rhesus CD3E Antibody (CBMOAB-38700FYA)
Cat: CBMOAB-38700FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO38700FYA |
| Specificity | This antibody binds to Rhesus CD3E. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CD3E (CD3e Molecule) is a Protein Coding gene. Diseases associated with CD3E include Immunodeficiency 18 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and signal transducer activity. |
| Product Overview | Mouse Anti-Rhesus CD3E Antibody is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | T-cell surface glycoprotein CD3 epsilon chain; CD3E |
| UniProt ID | H9FCI9 |
| Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: AGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI. |
See other products for " CD3e "
| MO-AB-34518W | Mouse Anti-Ferret CD3e Antibody (MO-AB-34518W) |
| MO-AB-14497Y | Mouse Anti-Sheep CD3E Antibody (MO-AB-14497Y) |
| MO-AB-09825R | Mouse Anti-Cattle CD3E Antibody (MO-AB-09825R) |
| MOFY-0522-FY51 | Mouse Anti-CD3E Antibody (MOFY-0522-FY51) |
| MO-AB-01057Y | Mouse Anti-Chicken CD3E Antibody (MO-AB-01057Y) |
| MO-AB-24453R | Mouse Anti-Pig CD3E Antibody (MO-AB-24453R) |
| MO-AB-07526Y | Mouse Anti-Rabbit CD3E Antibody (MO-AB-07526Y) |
| MO-AB-24637H | Mouse Anti-Rat Cd3e Antibody (MO-AB-24637H) |
| MO-AB-29466W | Mouse Anti-Dog CD3E Antibody (MO-AB-29466W) |
| MO-AB-08896W | Mouse Anti-Cat CD3E Antibody (MO-AB-08896W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry