Mouse Anti-CD3E Antibody (CBMOAB-38700FYA)


Cat: CBMOAB-38700FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38700FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Pig (Sus scrofa), Porcine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO38700FYA 100 µg
MO-AB-01057Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01057Y 100 µg
MO-AB-07526Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07526Y 100 µg
MO-AB-08896W Monoclonal Cat (Felis catus) WB, ELISA MO08896W 100 µg
MO-AB-09825R Monoclonal Cattle (Bos taurus) WB, ELISA MO09825R 100 µg
MO-AB-14497Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14497Y 100 µg
MO-AB-24453R Monoclonal Pig (Sus scrofa) WB, ELISA MO24453R 100 µg
MO-AB-24637H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24637C 100 µg
MO-AB-29466W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29466W 100 µg
MO-AB-34518W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34518W 100 µg
MOFY-0522-FY51 Monoclonal Porcine FC, IHC 100 µg
MOFY-0522-FY59 Monoclonal Porcine FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Pig (Sus scrofa), Porcine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO38700FYA
SpecificityThis antibody binds to Rhesus CD3E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD3E Antibody is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 epsilon chain; CD3E
UniProt IDH9FCI9
Protein RefseqThe length of the protein is 42 amino acids long.
The sequence is show below: AGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry