Mouse Anti-CD3E Antibody (CBMOAB-38700FYA)
Cat: CBMOAB-38700FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38700FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Pig (Sus scrofa), Porcine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO38700FYA | 100 µg | ||
MO-AB-01057Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01057Y | 100 µg | ||
MO-AB-07526Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07526Y | 100 µg | ||
MO-AB-08896W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08896W | 100 µg | ||
MO-AB-09825R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09825R | 100 µg | ||
MO-AB-14497Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14497Y | 100 µg | ||
MO-AB-24453R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24453R | 100 µg | ||
MO-AB-24637H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24637C | 100 µg | ||
MO-AB-29466W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29466W | 100 µg | ||
MO-AB-34518W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34518W | 100 µg | ||
MOFY-0522-FY51 | Monoclonal | Porcine | FC, IHC | 100 µg | |||
MOFY-0522-FY59 | Monoclonal | Porcine | FC | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Pig (Sus scrofa), Porcine, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO38700FYA |
Specificity | This antibody binds to Rhesus CD3E. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus CD3E Antibody is a mouse antibody against CD3E. It can be used for CD3E detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | T-cell surface glycoprotein CD3 epsilon chain; CD3E |
UniProt ID | H9FCI9 |
Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: AGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry