Mouse Anti-Rhesus CD74 Antibody (CBMOAB-38737FYA)


Cat: CBMOAB-38737FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38737FYA
SpecificityThis antibody binds to Rhesus CD74.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Nucleus; Golgi apparatus; Endoplasmic reticulum; Other locations; Lysosome; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD74 (CD74 Molecule) is a Protein Coding gene. Diseases associated with CD74 include Undifferentiated Pleomorphic Sarcoma and Mantle Cell Lymphoma. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Innate Immune System. Gene Ontology (GO) annotations related to this gene include identical protein binding and amyloid-beta binding.
Product OverviewMouse Anti-Rhesus CD74 Antibody is a mouse antibody against CD74. It can be used for CD74 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD74
UniProt IDF7E9S4
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MYRSSRRSCQEDQKPVMDDQRDLISNNEQLPMLGRRPGTPESKCSHGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTTQSLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGAQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKSTMETLDWKVFESWMHHWLLFEMSKHSLEQKPTEAPPKVLTKCQEEVSRIPAVHPGSFRPKCDENGNYLPLQCYGSTGYCWCVFPNGTEVPNTRSRGHQNCS.
See other products for " CD74 "
MO-AB-01066YMouse Anti-Chicken CD74 Antibody (MO-AB-01066Y)
MO-AB-23023HMouse Anti-Mallard CD74 Antibody (MO-AB-23023H)
MO-AB-09881RMouse Anti-Cattle CD74 Antibody (MO-AB-09881R)
MO-AB-24650HMouse Anti-Rat Cd74 Antibody (MO-AB-24650H)
MO-AB-24483RMouse Anti-Pig cd74 Antibody (MO-AB-24483R)
MO-AB-01566WMouse Anti-Rhesus CD74 Antibody (MO-AB-01566W)
MO-AB-02213HMouse Anti-Frog cd74 Antibody (MO-AB-02213H)
For Research Use Only | Not For Clinical Use.
Online Inquiry