AibGenesis™ Mouse Anti-CD74 Antibody (CBMOAB-38737FYA)


Cat: CBMOAB-38737FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38737FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO38737FYA 100 µg
MO-AB-01066Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01066Y 100 µg
MO-AB-01566W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01566W 100 µg
MO-AB-02213H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02213C 100 µg
MO-AB-09881R Monoclonal Cattle (Bos taurus) WB, ELISA MO09881R 100 µg
MO-AB-23023H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23023C 100 µg
MO-AB-24483R Monoclonal Pig (Sus scrofa) WB, ELISA MO24483R 100 µg
MO-AB-24650H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24650C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO38737FYA
SpecificityThis antibody binds to Rhesus CD74.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Nucleus; Golgi apparatus; Endoplasmic reticulum; Other locations; Lysosome; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD74 Antibody is a mouse antibody against CD74. It can be used for CD74 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD74
UniProt IDF7E9S4
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MYRSSRRSCQEDQKPVMDDQRDLISNNEQLPMLGRRPGTPESKCSHGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTTQSLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGAQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKSTMETLDWKVFESWMHHWLLFEMSKHSLEQKPTEAPPKVLTKCQEEVSRIPAVHPGSFRPKCDENGNYLPLQCYGSTGYCWCVFPNGTEVPNTRSRGHQNCS.
For Research Use Only | Not For Clinical Use.
Online Inquiry