AibGenesis™ Mouse Anti-CDCP2 Antibody (CBMOAB-38815FYA)


Cat: CBMOAB-38815FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38815FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO38815FYA 100 µg
CBMOAB-69834FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69834FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO38815FYA
SpecificityThis antibody binds to Rhesus CDCP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CDCP2 Antibody is a mouse antibody against CDCP2. It can be used for CDCP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCDCP2
UniProt IDF7DDA2
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MLAERGACLLLAVALLGPGPWAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVVFHSDKHVASHGFSAGYQKDVCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGPASVKLVFVDFQVEGNEECTYDYVAVLGGPGPTRGHHYCGSTRPPTLVSLGHELQVIFKSDFNIGGRGFKAYYFSGQCQEVYMTMRGNFSSPRYPSSYPNNIRCHWTIRLPPGYRVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQLLLLLHTDRSTTHRGFSVAYIGGQLGCGSGSTEGEGEALQPQSLSLFPPSYQFVLPPMNGLLQCLFRWLYLCPLSGPLRLDGTALACFHYCRASFPSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry