Mouse Anti-CDK2AP2 Antibody (CBMOAB-38844FYA)


Cat: CBMOAB-38844FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38844FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38844FYA 100 µg
CBMOAB-69907FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69907FYA 100 µg
MO-AB-09976R Monoclonal Cattle (Bos taurus) WB, ELISA MO09976R 100 µg
MO-AB-24685H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24685C 100 µg
MO-AB-25082W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25082W 100 µg
MO-AB-52708W Monoclonal Marmoset WB, ELISA MO52708W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38844FYA
SpecificityThis antibody binds to Rhesus CDK2AP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CDK2AP2 Antibody is a mouse antibody against CDK2AP2. It can be used for CDK2AP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-dependent kinase 2-associated protein 2; CDK2AP2
UniProt IDI0FJX0
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MFYRSIMPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAAAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART.
For Research Use Only | Not For Clinical Use.
Online Inquiry