Mouse Anti-CEACAM19 Antibody (MO-AB-03499W)


Cat: MO-AB-03499W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03499W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO03499W 100 µg
MO-AB-10026R Monoclonal Cattle (Bos taurus) WB, ELISA MO10026R 100 µg
MO-AB-52763W Monoclonal Marmoset WB, ELISA MO52763W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO03499W
SpecificityThis antibody binds to Rhesus CEACAM19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCEACAM19 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 19) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CEACAM19 Antibody is a mouse antibody against CEACAM19. It can be used for CEACAM19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarcinoembryonic Antigen Related Cell Adhesion Molecule 19; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19; Carcinoembryonic Antigen-Like 1; CEAL1; CEACM19
UniProt IDF6QMB9
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALHIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEEMYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAVTINSEWTMKAKTEVQVAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry