AibGenesis™ Mouse Anti-CELF5 Antibody (CBMOAB-38941FYA)


Cat: CBMOAB-38941FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38941FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset WB, ELISA MO38941FYA 100 µg
MO-AB-02322H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02322C 100 µg
MO-AB-52788W Monoclonal Marmoset WB, ELISA MO52788W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset
CloneMO38941FYA
SpecificityThis antibody binds to Rhesus CELF5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus CELF5 Antibody is a mouse antibody against CELF5. It can be used for CELF5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCELF5
UniProt IDF6RXK4
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MARPIQVKPADSESRGGDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGDWRVPGRDSERGGASCSSACTGHKNPGGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGLNEVLKQDETVHEQMQNSGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry