Mouse Anti-Rhesus CFP Antibody (CBMOAB-39102FYA)


Cat: CBMOAB-39102FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO39102FYA
SpecificityThis antibody binds to Rhesus CFP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product OverviewMouse Anti-Rhesus CFP Antibody is a mouse antibody against CFP. It can be used for CFP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProperdin; CFP
UniProt IDH9Z2N8
Protein RefseqThe length of the protein is 469 amino acids long.
The sequence is show below: MITEGAQAPCLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVKDCCLNTAYAYQERNGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSEKVALGTLEWQLQACEDKQCCPEMGGWSDWGPWEPCSVTCSKGMRTRRRACDHPAPKCGGHCPGEAQESEACDTQQVCPTHGAWAAWGPWSPCSGSCHGGPHEPKETRSRTCSAPEPSQKPPGKPCPGPAYEHRKCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTIERRTCNRPVPQHGGPSCAGDATRTHICNTAVPCPVDGEWDLWGQWSTCVRRNMKSISCEEIPGQQSRWRTCKGRKFDGHRCTGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEKL.
See other products for " cfp "
MO-AB-02361HMouse Anti-Frog cfp Antibody (MO-AB-02361H)
MO-AB-41384WMouse Anti-Guinea pig CFP Antibody (MO-AB-41384W)
MO-AB-10118RMouse Anti-Cattle CFP Antibody (MO-AB-10118R)
MO-AB-52881WMouse Anti-Marmoset CFP Antibody (MO-AB-52881W)
CBMOAB-70233FYAMouse Anti-Zebrafish cfp Antibody (CBMOAB-70233FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry