AibGenesis™ Mouse Anti-CFP Antibody (CBMOAB-39102FYA)


Cat: CBMOAB-39102FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39102FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset WB, ELISA MO39102FYA 100 µg
MO-AB-41384W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41384W 100 µg
MO-AB-52881W Monoclonal Marmoset WB, ELISA MO52881W 100 µg
MO-AB-02361H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02361C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset
CloneMO39102FYA
SpecificityThis antibody binds to Rhesus CFP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified. (From NCBI)
Product OverviewMouse Anti-Rhesus CFP Antibody is a mouse antibody against CFP. It can be used for CFP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProperdin; CFP
UniProt IDH9Z2N8
Protein RefseqThe length of the protein is 469 amino acids long.
The sequence is show below: MITEGAQAPCLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVKDCCLNTAYAYQERNGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSEKVALGTLEWQLQACEDKQCCPEMGGWSDWGPWEPCSVTCSKGMRTRRRACDHPAPKCGGHCPGEAQESEACDTQQVCPTHGAWAAWGPWSPCSGSCHGGPHEPKETRSRTCSAPEPSQKPPGKPCPGPAYEHRKCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTIERRTCNRPVPQHGGPSCAGDATRTHICNTAVPCPVDGEWDLWGQWSTCVRRNMKSISCEEIPGQQSRWRTCKGRKFDGHRCTGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry