AibGenesis™ Mouse Anti-CHCHD10 Antibody (CBMOAB-39131FYA)


Cat: CBMOAB-39131FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39131FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39131FYA 100 µg
CBMOAB-70293FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70293FYA 100 µg
MO-AB-10139R Monoclonal Cattle (Bos taurus) WB, ELISA MO10139R 100 µg
MO-AB-21787W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21787W 100 µg
MO-AB-24755H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24755C 100 µg
MO-AB-34547W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34547W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39131FYA
SpecificityThis antibody binds to Rhesus CHCHD10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyotrophic lateral sclerosis-2. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7 and 19. (From NCBI)
Product OverviewMouse Anti-Rhesus CHCHD10 Antibody is a mouse antibody against CHCHD10. It can be used for CHCHD10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial; CHCHD10
UniProt IDI2CV42
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MPRGSRSMASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAAQQAPTPTAPQHLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYNHGLSSLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry