Mouse Anti-CIB4 Antibody (CBMOAB-39268FYA)


Cat: CBMOAB-39268FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39268FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO39268FYA 100 µg
MO-AB-10245R Monoclonal Cattle (Bos taurus) WB, ELISA MO10245R 100 µg
MO-AB-14572Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14572Y 100 µg
MO-AB-24795H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24795C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO39268FYA
SpecificityThis antibody binds to Rhesus CIB4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CIB4 Antibody is a mouse antibody against CIB4. It can be used for CIB4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCIB4
UniProt IDF7BSN2
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHV.
For Research Use Only | Not For Clinical Use.
Online Inquiry