AibGenesis™ Mouse Anti-CLEC12B Antibody (MO-AB-01655W)


Cat: MO-AB-01655W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01655W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO01655W 100 µg
MO-AB-10326R Monoclonal Cattle (Bos taurus) WB, ELISA MO10326R 100 µg
MO-AB-24662R Monoclonal Pig (Sus scrofa) WB, ELISA MO24662R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO01655W
SpecificityThis antibody binds to Rhesus CLEC12B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CLEC12B Antibody is a mouse antibody against CLEC12B. It can be used for CLEC12B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-type lectin domain family 12 member B isoform 1; CLEC12B
UniProt IDI2CVJ0
Protein RefseqThe length of the protein is 276 amino acids long.
The sequence is show below: MSEEVTYATLTFQDYAGARNNRHGNNLRKKGHPAPSPIWRHAALGLLTLCLMLLIGLVTLGMMFLQISNDINSDSEKLSQLQKTIHQRQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAVKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWTNSRKDCIDKNSTLVKIDSLEEKNFLTSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKIEDLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry