Mouse Anti-CLEC2L Antibody (CBMOAB-39358FYA)


Cat: CBMOAB-39358FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39358FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO39358FYA 100 µg
MO-AB-24852H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24852C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO39358FYA
SpecificityThis antibody binds to Rhesus CLEC2L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CLEC2L Antibody is a mouse antibody against CLEC2L. It can be used for CLEC2L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-type lectin domain family 2 member L; CLEC2L
UniProt IDH9FA74
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: RPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLLLGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT.
For Research Use Only | Not For Clinical Use.
Online Inquiry