Mouse Anti-Rhesus CLPS Antibody (CBMOAB-39416FYA)
Cat: CBMOAB-39416FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO39416FYA |
Specificity | This antibody binds to Rhesus CLPS. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus CLPS Antibody is a mouse antibody against CLPS. It can be used for CLPS detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CLPS |
UniProt ID | F6TXW9 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: ILILLLVALSVAYAAPGPRGIIINLTLYGIYYKCPCERGLTCEGDKTIVGAITNTNFGVCHDIGTLDAPSSETAHPLPYLAQNA. |
See other products for " clpS "
CBMOAB-0383YC | Mouse Anti-E. coli clpS Antibody (CBMOAB-0383YC) |
MO-AB-29603W | Mouse Anti-Dog CLPS Antibody (MO-AB-29603W) |
MO-DKB-00254W | Rabbit Anti-clpS Antibody (MO-DKB-00254W) |
MO-AB-07642Y | Mouse Anti-Rabbit CLPS Antibody (MO-AB-07642Y) |
MO-AB-01243Y | Mouse Anti-Chicken CLPS Antibody (MO-AB-01243Y) |
MO-AB-44087W | Mouse Anti-Horse CLPS Antibody (MO-AB-44087W) |
MO-AB-10358R | Mouse Anti-Cattle CLPS Antibody (MO-AB-10358R) |
MO-AB-24682R | Mouse Anti-Pig CLPS Antibody (MO-AB-24682R) |
MO-DKB-0130RA | Rabbit Anti-ClpS Antibody (MO-DKB-0130RA) |
MO-AB-24888H | Mouse Anti-Rat Clps Antibody (MO-AB-24888H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry