Mouse Anti-CLPS Antibody (CBMOAB-39416FYA)


Cat: CBMOAB-39416FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39416FYA Monoclonal Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), E. coli (Escherichia coli ), E. coli (Escherichia coli), Pig (Sus scrofa) WB, ELISA MO39416FYA 100 µg
CBMOAB-0383YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0383YC 100 µg
MO-AB-29603W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29603W 100 µg
MO-AB-10358R Monoclonal Cattle (Bos taurus) WB, ELISA MO10358R 100 µg
MO-AB-24682R Monoclonal Pig (Sus scrofa) WB, ELISA MO24682R 100 µg
MO-DKB-00254W Polyclonal E. coli (Escherichia coli) ELISA, WB 100 µg
MO-DKB-0130RA Polyclonal A. thaliana (Arabidopsis thaliana) WB 200 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Dog (Canis lupus familiaris), E. coli (Escherichia coli ), E. coli (Escherichia coli), Pig (Sus scrofa)
CloneMO39416FYA
SpecificityThis antibody binds to Rhesus CLPS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus CLPS Antibody is a mouse antibody against CLPS. It can be used for CLPS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLPS
UniProt IDF6TXW9
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: ILILLLVALSVAYAAPGPRGIIINLTLYGIYYKCPCERGLTCEGDKTIVGAITNTNFGVCHDIGTLDAPSSETAHPLPYLAQNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry