AibGenesis™ Mouse Anti-CLRN2 Antibody (CBMOAB-39428FYA)


Cat: CBMOAB-39428FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39428FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO39428FYA 100 µg
MO-AB-24896H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24896C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO39428FYA
SpecificityThis antibody binds to Rhesus CLRN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the clarin family of genes. The clarins appear to belong to a large superfamily of small integral membrane glycoproteins with four transmembrane domains. The exact function of this gene is unknown. (From NCBI)
Product OverviewMouse Anti-Rhesus CLRN2 Antibody is a mouse antibody against CLRN2. It can be used for CLRN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLRN2
UniProt IDF6TQN4
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MPGWFKKAWYGLASLLSFSSFILIIVALVVPHWLSGKILCQTGVDLVNATDRELVKFIGDIYYGLFRGCKVRQCGLGSRQSQFTIFPHLVKELNAGLHVMILLLLFLALALALVSMGFAILNMIQVPYQAVNGPGGICLWNVLAGGVVALAIASFMAAVKFHDLTERIANFQEKLFQFVVLEEQYEESFWICVASALAHAANLVVVAISHIPLPEIKTKIEEATVTAEDILY.
For Research Use Only | Not For Clinical Use.
Online Inquiry