AibGenesis™ Mouse Anti-CMSS1 Antibody (CBMOAB-39466FYA)


Cat: CBMOAB-39466FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39466FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO39466FYA 100 µg
CBMOAB-70872FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70872FYA 100 µg
MO-AB-11342W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11342W 100 µg
MO-AB-53236W Monoclonal Marmoset WB, ELISA MO53236W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO39466FYA
SpecificityThis antibody binds to Rhesus CMSS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CMSS1 Antibody is a mouse antibody against CMSS1. It can be used for CMSS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMSS1
UniProt IDF7GZZ0
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: EASDGEGGGDTEVMQQETVPVPVPSEETKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRSVIELEELNLPDSCFLKANDLTHSLSSYLKEICPKWVKLRKNHSEKKAVLMLIICSSAIRALELIRSMTAFRGDSKVIKLFAKHIKVQEQVKLLEKRVVHLGVGTPGRIKELVKQGGFNLNPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry