Mouse Anti-Rhesus CMTM7 Antibody (CBMOAB-39476FYA)


Cat: CBMOAB-39476FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO39476FYA
SpecificityThis antibody binds to Rhesus CMTM7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus CMTM7 Antibody is a mouse antibody against CMTM7. It can be used for CMTM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMTM7
UniProt IDF6Y4G7
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MAVLQDLVCNPVHRYSRLMRPQPLGPSGALQRGRVLQARPVDLCSCAKVLSGWWEPGKKGLPPLPVLPGSQLPELLSQPETLPPAFRGEYSSPSGKGKQPPGKSVFCLPASRTTSGTGGVCEYSCLNPFYFTPQWGVKRLKKQSPLLIYLACQSSLRDTLFPEARRACRNTMWLACP.
For Research Use Only | Not For Clinical Use.
Online Inquiry