Mouse Anti-CMTM7 Antibody (CBMOAB-39476FYA)


Cat: CBMOAB-39476FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39476FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39476FYA 100 µg
CBMOAB-70880FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70880FYA 100 µg
MO-AB-02497H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02497C 100 µg
MO-AB-10392R Monoclonal Cattle (Bos taurus) WB, ELISA MO10392R 100 µg
MO-AB-23913W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23913W 100 µg
MO-AB-24917H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24917C 100 µg
MO-AB-53242W Monoclonal Marmoset WB, ELISA MO53242W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39476FYA
SpecificityThis antibody binds to Rhesus CMTM7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus CMTM7 Antibody is a mouse antibody against CMTM7. It can be used for CMTM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMTM7
UniProt IDF6Y4G7
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MAVLQDLVCNPVHRYSRLMRPQPLGPSGALQRGRVLQARPVDLCSCAKVLSGWWEPGKKGLPPLPVLPGSQLPELLSQPETLPPAFRGEYSSPSGKGKQPPGKSVFCLPASRTTSGTGGVCEYSCLNPFYFTPQWGVKRLKKQSPLLIYLACQSSLRDTLFPEARRACRNTMWLACP.
For Research Use Only | Not For Clinical Use.
Online Inquiry