AibGenesis™ Mouse Anti-CMTM8 Antibody (CBMOAB-39477FYA)


Cat: CBMOAB-39477FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39477FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO39477FYA 100 µg
MO-AB-10393R Monoclonal Cattle (Bos taurus) WB, ELISA MO10393R 100 µg
MO-AB-15902W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15902W 100 µg
MO-AB-24918H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24918C 100 µg
MO-AB-53243W Monoclonal Marmoset WB, ELISA MO53243W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO39477FYA
SpecificityThis antibody binds to Rhesus CMTM8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor, and plays a role in regulating the migration of tumor cells. The encoded protein is thought to function as a a negative regulator of epidermal growth factor-induced signaling. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus CMTM8 Antibody is a mouse antibody against CMTM8. It can be used for CMTM8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCKLF-like MARVEL transmembrane domain-containing protein 8; CMTM8
UniProt IDH9F7K2
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: AYDREFLRTLPGLLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIVYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry